General Information

  • ID:  hor006469
  • Uniprot ID:  Q86SA8
  • Protein name:  Androgenic gland hormone A chain
  • Gene name:  AGH
  • Organism:  Porcellio dilatatus (Woodlouse)
  • Family:  NA
  • Source:  animal
  • Expression:  Androgenic gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Porcellio (genus), Porcellionidae (family), Crinocheta , Oniscidea (suborder), Isopoda (order), Peracarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007283 spermatogenesis; GO:0007548 sex differentiation; GO:0030154 cell differentiation
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DIAFHEECCNIRTEHKCNRTTVELYCRRYSP
  • Length:  31(116-146)
  • Propeptide:  MKGLLFIISLLFLTLHQRVWAYQVEGMKSDVICADIRFTVHCICNELGRFPTARLTKPCPWPNRERRSTDDEDYLFEEDEDEEFFHPRALSRPTAAKYDDEILEDEVSFHSRTKRDIAFHEECCNIRTEHKCNRTTVELYCRRYSP
  • Signal peptide:  MKGLLFIISLLFLTLHQRVWA
  • Modification:  NA
  • Glycosylation:  T18 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Controls sex differentiation and the formation of male appendages, spermatogenesis, pigmentation, and male specific behavior.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45917
  • Structure ID:  AF-Q86SA8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006469_AF2.pdbhor006469_ESM.pdb

Physical Information

Mass: 432354 Formula: C159H248N50O50S4
Absent amino acids: GMQW Common amino acids: CER
pI: 7.29 Basic residues: 7
Polar residues: 12 Hydrophobic residues: 6
Hydrophobicity: -91.29 Boman Index: -10647
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 50.32
Instability Index: 9018.06 Extinction Coefficient cystines: 3230
Absorbance 280nm: 107.67

Literature

  • PubMed ID:  12560604
  • Title:  Molecular cloning and expression analysis of cDNAs encoding androgenic gland hormone precursors from two porcellionidae species, Porcellio scaber and P. dilatatus.